DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and AT2G37540

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_181290.1 Gene:AT2G37540 / 818330 AraportID:AT2G37540 Length:321 Species:Arabidopsis thaliana


Alignment Length:307 Identity:110/307 - (35%)
Similarity:165/307 - (53%) Gaps:16/307 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 FDSCSTALQVLHGKDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQE 168
            |.|.|||..|....|....||:|||...|||.|.||.||..|..:|.|.||..:|..:.|.|.|.
plant    16 FGSASTAEDVTQAIDASHLTAIITGGTSGIGLEAARVLAMRGAHVIIAARNPKAANESKEMILQM 80

  Fly   169 RPAARSRCRFAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHL 233
            .|.|  |..:..:|:||::||:.||::.......::.||.||||...|:..|.||:|:.|..:|:
plant    81 NPNA--RVDYLQIDVSSIKSVRSFVDQFLALNVPLNILINNAGVMFCPFKLTEDGIESQFATNHI 143

  Fly   234 SHFYLT-LQLETL------FDYKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNA 291
            .||.|| |.|:.:      ...:.||:.|||.:|.:..  .|.:....:: .|..|....||..:
plant   144 GHFLLTNLLLDKMKSTARESGVQGRIVNLSSIAHTYTY--SEGIKFQGIN-DPAGYSERRAYGQS 205

  Fly   292 KLCNVLFAQELAQRWKQRG--ISVFSLHPGNMVSSDLSRNYWFYRLLF-AIVRPFTKSLQQAAAT 353
            ||.|:|.:..|::|.::.|  |::.|:||| :|:::|.|...|...:| |:...|.|::.|.|||
plant   206 KLSNLLHSNALSRRLQEEGVNITINSVHPG-LVTTNLFRYSGFSMKVFRAMTFLFWKNIPQGAAT 269

  Fly   354 SIYCATANELTGLSGLYFNNCFFCEPSKLSKSAALQQQLWKLSENLI 400
            :.|.|...:|.|::|.||.:|....|||.:.:.:|..:||..|..||
plant   270 TCYVALHPDLEGVTGKYFGDCNIVAPSKFATNNSLADKLWDFSVFLI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 110/307 (36%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 103/290 (36%)
AT2G37540NP_181290.1 retinol-DH_like_SDR_c_like 35..309 CDD:212492 98/279 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.