DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and DHRS12

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001364858.1 Gene:DHRS12 / 79758 HGNCID:25832 Length:320 Species:Homo sapiens


Alignment Length:203 Identity:63/203 - (31%)
Similarity:90/203 - (44%) Gaps:16/203 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSS 185
            ||..|:||.|.|||..||..:|..|..:...||:::.||.|...|.:|  :.........:|||.
Human    40 GRVFLVTGGNSGIGKATALEIAKRGGTVHLVCRDQAPAEDARGEIIRE--SGNQNIFLHIVDLSD 102

  Fly   186 LRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLTLQLETLF--DY 248
            .:.:.:|||..||. ..:..||.|||........|.||||..|..:.|..:.||..|..:.  ::
Human   103 PKQIWKFVENFKQE-HKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEH 166

  Fly   249 KTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWKQ--RGI 311
            ..|:|.:||     ..:.|:.|..:.|......:...|.|...|...|:    |.:||.|  ..|
Human   167 DPRVITVSS-----GGMLVQKLNTNDLQSERTPFDGTMVYAQNKRQQVV----LTERWAQGHPAI 222

  Fly   312 SVFSLHPG 319
            ...|:|||
Human   223 HFSSMHPG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 63/203 (31%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 63/203 (31%)
DHRS12NP_001364858.1 NADB_Rossmann 40..>235 CDD:419666 63/203 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.