Sequence 1: | NP_001285735.1 | Gene: | Wwox / 34090 | FlyBaseID: | FBgn0031972 | Length: | 409 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001364858.1 | Gene: | DHRS12 / 79758 | HGNCID: | 25832 | Length: | 320 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 63/203 - (31%) |
---|---|---|---|
Similarity: | 90/203 - (44%) | Gaps: | 16/203 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 121 GRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSS 185
Fly 186 LRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLTLQLETLF--DY 248
Fly 249 KTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWKQ--RGI 311
Fly 312 SVFSLHPG 319 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Wwox | NP_001285735.1 | WW | 13..43 | CDD:197736 | |
WW | 54..86 | CDD:197736 | |||
PRK06196 | 104..402 | CDD:235736 | 63/203 (31%) | ||
human_WWOX_like_SDR_c-like | 121..402 | CDD:187669 | 63/203 (31%) | ||
DHRS12 | NP_001364858.1 | NADB_Rossmann | 40..>235 | CDD:419666 | 63/203 (31%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1208 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |