DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and si:dkey-174n20.1

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_005165244.1 Gene:si:dkey-174n20.1 / 796174 ZFINID:ZDB-GENE-030131-7890 Length:308 Species:Danio rerio


Alignment Length:300 Identity:99/300 - (33%)
Similarity:157/300 - (52%) Gaps:40/300 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARS---RCRF 178
            |.|.|:|.||||.|.|||.|||.:||..|..:|.|||:...|..|:..|     .|||   ....
Zfish    30 KRLDGKTVLITGGNSGIGKETAVALAMRGARVIIACRDEEKARKAVREI-----KARSHNMNVLH 89

  Fly   179 AALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGV-FALPYTRTVDGLETTFQVSHLSHFYLT-LQ 241
            ..:||:::||::.|.:...|....:|.||.|||: ..|.:|.  |.....|.|:||.||.|| |.
Zfish    90 MEVDLANMRSIREFSKTFLQKEKRLDILINNAGMPGVLDWTD--DNFSMCFGVNHLGHFLLTNLL 152

  Fly   242 LETLFDYK-TRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQR 305
            |..|.:.. :|:|.|:..|:::..|..::|. ::|.|       ...|..:||.|:.|.||||:.
Zfish   153 LPRLKESSPSRVINLTCSSYKYQKLNFQDLN-YNLFP-------FFTYCRSKLANIYFTQELARM 209

  Fly   306 WKQRGISVFSLHPGNMVSSDLSRNYW------FYRLLFAIVR-PFTKSLQQAAATSIYCATANEL 363
            .:.:|::.:::|||.:      |:.|      .|::|..:|. .|..|.:..|.|.:|||.::|:
Zfish   210 MEGKGVTAYAVHPGYV------RSRWTCHFSVLYQILAQVVMFMFFVSCEAGAQTVVYCAVSDEV 268

  Fly   364 TGLSGLYFNNCFFCEPSKL---SKSAALQQQLWKLSENLI 400
            ...:|.||.:   |.|:.|   ::.:.:.::||:.||.|:
Zfish   269 LPRNGGYFTD---CRPAPLKAFARDSGVAKKLWEASERLV 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 99/299 (33%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 97/295 (33%)
si:dkey-174n20.1XP_005165244.1 PRK06197 28..304 CDD:235737 98/297 (33%)
NADB_Rossmann 34..301 CDD:304358 94/290 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.