DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and hsd17b7

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001070796.1 Gene:hsd17b7 / 768185 ZFINID:ZDB-GENE-061013-378 Length:340 Species:Danio rerio


Alignment Length:345 Identity:88/345 - (25%)
Similarity:141/345 - (40%) Gaps:86/345 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RTALITGANCGIGYETARSLAHHGC--EIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLS 184
            :..|:||||.|||......|.:...  |:..||||...||||.:.:....|.|  |.....||:.
Zfish     3 KVVLVTGANSGIGLALCERLLNEDAQIELCLACRNMQRAEAARKALLVSHPQA--RVSLLHLDVG 65

  Fly   185 SLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVD--------------------------- 222
            ::.||.:..||.|:..:.:|||.||||:...|   |||                           
Zfish    66 NMHSVVKGAEEFKKKFNRLDYLYLNAGIMPNP---TVDHVAFYRGLFSRNAIKMLTTGEGILTQE 127

  Fly   223 ------GLETTFQVSHLSHFYLTLQLETLF---DYKTRIIVLSSESHRFANLPVENLAVHHLSPP 278
                  ||:..|..:...||.|..:||.|.   ::.:.:|..||.:.:.::..:|:  |.|.:.|
Zfish   128 DKVTPIGLQEVFATNLFGHFLLVKELEPLLCQTEHNSLVIWTSSSNAQRSSFNLED--VQHKNGP 190

  Fly   279 PEKYWSMMAYNNAKLCNVLFAQELAQRWKQRGISVFSLHPG----NMVSSDLSRNYW--FYRLLF 337
                   :.|:::|..:.|.:..|.:.:..:|:....:.||    |:....|...:|  ...:||
Zfish   191 -------LPYSSSKYASDLLSLALNRHYNSQGMFSSVICPGLVMTNLTYGILPSLFWTIIMPILF 248

  Fly   338 AIVRPFTKSLQQA---AATSIY------------CATANELTGLSGLYFNNCFFCEPSKLSKSAA 387
             ::|.||.|...:   .|.::|            .|..:.||  |||..|   :..|||:.... 
Zfish   249 -LIRIFTNSFTLSPYNGAEALYWLFKQKPESLDPMAKYHSLT--SGLGNN---YTRPSKMDLDE- 306

  Fly   388 LQQQLWKLSENLIAELVEQE 407
                  .:||....:|:|.|
Zfish   307 ------NMSEAFYVKLLELE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 85/338 (25%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 85/338 (25%)
hsd17b7NP_001070796.1 3KS_SDR_c 2..280 CDD:187645 73/291 (25%)
adh_short 3..231 CDD:278532 63/241 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1413827at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R408
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.