DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and dhrs12la

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_987120.1 Gene:dhrs12la / 677747 ZFINID:ZDB-GENE-030131-8104 Length:320 Species:Danio rerio


Alignment Length:258 Identity:73/258 - (28%)
Similarity:106/258 - (41%) Gaps:34/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KDLH----GRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCR 177
            |||.    ||:.:|||||.|||...|.::|..|..:...|||:..||.|...|.:|  :......
Zfish    32 KDLETSMAGRSFMITGANSGIGKAAAMAIAKKGGTVHMVCRNKDKAEEARAEIVKE--SGNKEIY 94

  Fly   178 FAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLTLQL 242
            ...||||..:.|..|||..|:....::.||.|||..........:|||.:|..:.|:.|.....|
Zfish    95 VHILDLSETKKVWEFVESFKKKYKTLNVLINNAGCMMTKREVNGEGLEKSFASNSLAVFIFIKSL 159

  Fly   243 ETLFDYK--TRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQR 305
            ..|.:..  .|:|.:||     ..:.|:.|...:|.....:|...|.|...|...|:..::.|:.
Zfish   160 IPLLEKSPDPRVITVSS-----GGMLVQKLRTGNLQSQRGRYDGTMVYAQNKRQQVVMTEQFAKA 219

  Fly   306 WKQRGISVFSLHPGNMVSSDLSRNYWFYRLLFAIVRP-FTKSL-------QQAAATSIYCATA 360
            ......||  :|||           |......|...| |..|:       :|.|.|.::.|.:
Zfish   220 HPSIHFSV--MHPG-----------WVDTPTIANAMPDFHSSMKERLRTTEQGADTVVWLAVS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 73/258 (28%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 70/250 (28%)
dhrs12laNP_987120.1 FabG 37..273 CDD:223959 70/253 (28%)
DHRS-12_like_SDR_c-like 40..294 CDD:187668 70/250 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.