DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and RDH14

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_065956.1 Gene:RDH14 / 57665 HGNCID:19979 Length:336 Species:Homo sapiens


Alignment Length:304 Identity:113/304 - (37%)
Similarity:169/304 - (55%) Gaps:28/304 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQE-RPAAR--------- 173
            :||:|.||||||.|:|..||..|...|..:|..||:|:.||.|..::.:| |.||.         
Human    41 MHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQAAECGPEPGVSG 105

  Fly   174 -SRCRFAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFY 237
             .......|||:|||||:.|.:|:.|....:|.||.|||:|..||.:|.||.|..|.|:||.||.
Human   106 VGELIVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFGVNHLGHFL 170

  Fly   238 LTLQLETLF--DYKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQ 300
            ||..|..|.  ...:||:|:||:.:::.::..::|      ...:.|.....|:.:||.|:||.:
Human   171 LTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFDDL------NSEQSYNKSFCYSRSKLANILFTR 229

  Fly   301 ELAQRWKQRGISVFSLHPGNMVSSDLSRNYWFYRL---LFAIVR-PFTKSLQQAAATSIYCATAN 361
            |||:|.:...::|..|||| :|.::|.|:.....|   ||.:|. .|.|:..:.|.||||.|::.
Human   230 ELARRLEGTNVTVNVLHPG-IVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPVEGAQTSIYLASSP 293

  Fly   362 ELTGLSGLYFNNCFFCE--PSKLSKSAALQQQLWKLSENLIAEL 403
            |:.|:||.||.:|...|  |..:.:|.|  ::||.:||.::..|
Human   294 EVEGVSGRYFGDCKEEELLPKAMDESVA--RKLWDISEVMVGLL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 112/301 (37%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 111/299 (37%)
RDH14NP_065956.1 retinol-DH_like_SDR_c 43..328 CDD:212495 109/293 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.