DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and zgc:112332

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001018519.1 Gene:zgc:112332 / 553712 ZFINID:ZDB-GENE-050522-387 Length:298 Species:Danio rerio


Alignment Length:285 Identity:107/285 - (37%)
Similarity:161/285 - (56%) Gaps:20/285 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDL 183
            |..:|.:|||||.|||.||||.||..|..::.|||:...||||...:...  :.........|||
Zfish    18 LDEKTVIITGANTGIGKETARDLARRGARVVMACRDLEKAEAARRELMDN--SGNQNIVVKKLDL 80

  Fly   184 SSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLTLQLETLFDY 248
            :..:|::.|.|.|.:....::.||.|||:...||::|.||.|..|.|:||.||.|...|..|...
Zfish    81 ADTKSIKAFAELINKEEKQVNILINNAGIMMCPYSKTADGFEMQFGVNHLGHFLLIYLLLDLLKK 145

  Fly   249 KT--RIIVLSSESHRFANLPVENLAVHHLSPPPEKYWS-MMAYNNAKLCNVLFAQELAQRWKQRG 310
            .|  ||:.::|.:|.::.:.:|::       ..||.:| ..||..:||.|:|..:.||:|.:..|
Zfish   146 STPSRIVNVASVAHTWSGIHLEDI-------NSEKVYSPRRAYGQSKLANILCTRSLAKRLQGSG 203

  Fly   311 ISVFSLHPGNMVSSDLSRNYWF-YRLLFAIVRPFTKSLQQAAATSIYCATANELTGLSGLYFNNC 374
            ::|:||||| :|.|:|.||... .::.|.:..||||:..|.|.|:||||...||...||.|::: 
Zfish   204 VNVYSLHPG-VVQSELFRNLSKPAQIAFKVFSPFTKTTSQGAQTTIYCAIEPELDRESGGYYSD- 266

  Fly   375 FFCEPSKLSKSAA---LQQQLWKLS 396
              |.|::.|:.|:   :.|:||:||
Zfish   267 --CGPAQCSREASDDEMAQKLWELS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 107/285 (38%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 106/283 (37%)
zgc:112332NP_001018519.1 PRK06197 11..297 CDD:235737 107/285 (38%)
NADB_Rossmann 21..289 CDD:304358 104/280 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.