DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and hsd17b7

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001016209.1 Gene:hsd17b7 / 548963 XenbaseID:XB-GENE-976825 Length:334 Species:Xenopus tropicalis


Alignment Length:339 Identity:80/339 - (23%)
Similarity:139/339 - (41%) Gaps:72/339 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RTALITGANCGIGYETARSLAHHGCEI--IFACRNRSSAEAAIERIAQERPAARSRCRFAALDLS 184
            :..::||||.|||:.....|..:..:|  ...|||...||||...:....|.|  ......:|:.
 Frog     3 KVVVVTGANSGIGFALCERLLSYDDQIRLCLGCRNLQRAEAARTALLSSHPTA--DVSVLLVDVG 65

  Fly   185 SLRSVQRFVEEIKQSVSHIDYLILNAGVFALP-----------YTRTV----------------- 221
            .:.||.|..:|:|:....:|||.||||:...|           ::|.|                 
 Frog    66 KVTSVVRAAKELKERYKKVDYLYLNAGIMPNPQLSFRAFIKGLFSRNVINMFATAEGILTQKDRI 130

  Fly   222 --DGLETTFQVSHLSHFYLTLQLETLF---DYKTRIIVLSSESHRFANLPVENLAVHHLSPPPEK 281
              |||:..|:.:...||.|..::|.|.   |..:::|..||.:.|.:...:.:.. |.....|  
 Frog   131 TEDGLQEVFETNVFGHFMLIREIEPLLCHADSTSQLIWTSSSNARKSAFSLSDYQ-HSQGQEP-- 192

  Fly   282 YWSMMAYNNAKLCNVLFAQELAQRWKQRGISVFSLHPGNMVSSDLSRNY---WFYRLLFAI---V 340
                  |:::|....|.:..|.:::.::|:....:.|| :|.::|:...   :|:.|:..|   :
 Frog   193 ------YSSSKYATDLLSVALNKQYNKQGLYSSVVCPG-LVMTNLTYGIMPSFFWTLIMPIMWLI 250

  Fly   341 RPFTKSLQ------QAAATSIYCATANELTGLSGLY-----FNNCFFCEPSKLSKSAALQQQLWK 394
            |.||.|..      ..|...::...|..|..||..:     ..|.:.|    |||....:    |
 Frog   251 RVFTNSFTISPFNGAEALMWLFNQKAESLDPLSKYHSCTSGLGNNYVC----LSKMDVDE----K 307

  Fly   395 LSENLIAELVEQEQ 408
            ..:.|:.:::|.|:
 Frog   308 SGDLLLQKMLELEK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 78/331 (24%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 78/331 (24%)
hsd17b7NP_001016209.1 3KS_SDR_c 2..280 CDD:187645 68/288 (24%)
adh_short 3..231 CDD:278532 58/239 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1413827at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.