DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and RDH11

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_057110.3 Gene:RDH11 / 51109 HGNCID:17964 Length:318 Species:Homo sapiens


Alignment Length:307 Identity:108/307 - (35%)
Similarity:168/307 - (54%) Gaps:21/307 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 QVRQRFDS--CSTALQVLHGKDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAA 161
            |:|:...|  |::.:|      |.|:..::||||.|||.|||:.||..|..:..|||:....|..
Human    23 QIRKMLSSGVCTSTVQ------LPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELV 81

  Fly   162 IERIAQERPAARSRCRFAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLET 226
            .:.|  :......:.....||||..:|::.|.:.......|:..||.||||...||::|.||.|.
Human    82 AKEI--QTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEM 144

  Fly   227 TFQVSHLSHFYLT-LQLETLFD-YKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSM-MAY 288
            ...|:||.||.|| |.||.|.: ..:||:.:||.:|....:...||       ..||:::. :||
Human   145 HIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNL-------QGEKFYNAGLAY 202

  Fly   289 NNAKLCNVLFAQELAQRWKQRGISVFSLHPGNMVSSDLSRNYWFYRLLFAIVRPFTKSLQQAAAT 353
            .::||.|:||.||||:|.|..|::.:|:|||. |.|:|.|:..|.|.::.:...|.|:.||.|.|
Human   203 CHSKLANILFTQELARRLKGSGVTTYSVHPGT-VQSELVRHSSFMRWMWWLFSFFIKTPQQGAQT 266

  Fly   354 SIYCATANELTGLSGLYFNNCFFCEPSKLSKSAALQQQLWKLSENLI 400
            |::||....|..|||.:|::|.....|..:::..:.::||.:|.:|:
Human   267 SLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 106/302 (35%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 102/283 (36%)
RDH11NP_057110.3 PRK06197 41..314 CDD:235737 102/283 (36%)
NADB_Rossmann 41..309 CDD:304358 100/277 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.