DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and Rdh14

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001102746.1 Gene:Rdh14 / 500629 RGDID:1565196 Length:334 Species:Rattus norvegicus


Alignment Length:301 Identity:114/301 - (37%)
Similarity:168/301 - (55%) Gaps:25/301 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQE--------RPAARSR 175
            :||:|.||||||.|:|..||..|...|..:|..||:|:.||.|..::.||        ..|...:
  Rat    42 MHGKTVLITGANSGLGRATAGELLRLGARVIMGCRDRARAEEAAGQLRQELGQAGGLGPDATDGQ 106

  Fly   176 CRFAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLTL 240
            .....|||:|||||:.|.:|:.|....:|.||.|||||..|||:|.||.|..|.|:||.||.||.
  Rat   107 LVVKELDLASLRSVRAFCQELLQEEPRLDVLINNAGVFQCPYTKTEDGFEMQFGVNHLGHFLLTN 171

  Fly   241 QLETLF--DYKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELA 303
            .|..|.  ...:||:|:||:.:::.::..|:|      ...:.|.....|:.:||.|:||.:|||
  Rat   172 LLLGLLKSSAPSRIVVVSSKLYKYGDINFEDL------NSEQSYNKSFCYSRSKLANILFTRELA 230

  Fly   304 QRWKQRGISVFSLHPGNMVSSDLSRNY---WFYRLLFAIVR-PFTKSLQQAAATSIYCATANELT 364
            .|.:...::|..|||| :|.::|.|:.   ...|.||.:|. .|.|:..:.|.||||.|::.::.
  Rat   231 HRLEGTNVTVNVLHPG-IVRTNLGRHIHIPLLARPLFNLVSWAFFKTPLEGAQTSIYLASSPDVE 294

  Fly   365 GLSGLYFNNCFFCE--PSKLSKSAALQQQLWKLSENLIAEL 403
            |:||.||.:|...|  |..:.:|.|  ::||.:||.::..|
  Rat   295 GVSGRYFGDCKEEELLPKAMDESVA--RKLWDISEVMVGIL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 113/298 (38%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 112/296 (38%)
Rdh14NP_001102746.1 PRK06197 43..332 CDD:235737 113/297 (38%)
NADB_Rossmann 44..326 CDD:304358 110/290 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.