DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and rdh13

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001011000.1 Gene:rdh13 / 496409 XenbaseID:XB-GENE-965068 Length:329 Species:Xenopus tropicalis


Alignment Length:312 Identity:111/312 - (35%)
Similarity:163/312 - (52%) Gaps:28/312 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SCSTALQVLHGKDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERP 170
            :|.:...::      |:|.::||||.|||.|||..||..|..||.|||:....|.|...|   |.
 Frog    29 NCPSKASII------GQTVIVTGANTGIGKETALELAKRGGRIIMACRDMGKCENAARDI---RG 84

  Fly   171 AARSRCRFAA-LDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLS 234
            ...:...||. |||:|.:|::.|.:.|......:|.||.||.|...|:.:|.|..|..|.|:||.
 Frog    85 KTLNHNVFARHLDLASSKSIKEFAKTIINEEERVDVLINNAAVMRCPHWKTEDNFEMQFGVNHLG 149

  Fly   235 HFYLT-LQLETL-FDYKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVL 297
            ||.|| |.||.: ....:|||.:||.:|...::..::     |:...:||.:..||..:||.|||
 Frog   150 HFLLTNLLLEKMKRSENSRIINVSSLAHIAGDIDFDD-----LNWEKKKYNTKAAYCQSKLANVL 209

  Fly   298 FAQELAQRWKQRGISVFSLHPGNMVSSDLSRNYWFYRLLFA--IVRP----FTKSLQQAAATSIY 356
            |..|||:|.:...::..||||| :..::|.|:...::..|:  |:.|    ..||.:|||..|:|
 Frog   210 FTNELAKRLQGTKLTANSLHPG-VADTELGRHTGMHQSAFSSTILAPLFWFLVKSPKQAAQPSVY 273

  Fly   357 CATANELTGLSGLYFNNCFFCEPSKLSKSAALQQQLWKLSENLIAELVEQEQ 408
            .|.|..|.|:||.|||.....||:..:......::||:.|    |:||..|:
 Frog   274 LAVAENLQGVSGKYFNALKEKEPAPQALDEESARKLWEES----AKLVHLEE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 107/304 (35%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 106/289 (37%)
rdh13NP_001011000.1 retinol-DH_like_SDR_c 38..313 CDD:212495 105/283 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.