DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and dhrs13a.3

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001007425.2 Gene:dhrs13a.3 / 492783 ZFINID:ZDB-GENE-041114-134 Length:318 Species:Danio rerio


Alignment Length:291 Identity:109/291 - (37%)
Similarity:161/291 - (55%) Gaps:20/291 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDL 183
            |:|:||::||:|.|||..||..||..|..:|.||||:..||||:..|.:|  :..|...:..|||
Zfish    34 LNGKTAIVTGSNTGIGKTTALDLARRGARVILACRNQERAEAAVYDIRKE--SGNSEVLYMHLDL 96

  Fly   184 SSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLTLQLETLFD- 247
            :||:||:.|.|...::...:|.||.|||:.|  ..||.||....|.|:||.||.|||   .|.| 
Zfish    97 ASLQSVRDFAETFLKTEPRLDLLINNAGLIA--SGRTEDGFGMAFGVNHLGHFLLTL---LLLDR 156

  Fly   248 ----YKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYW-SMMAYNNAKLCNVLFAQELAQRWK 307
                ..:|::.:|:..||..:|....|.........:.|| ::.||.::|||||||.:|||.|.:
Zfish   157 LKQSENSRVVNVSALLHRLGSLDFNLLNTQKDLVTGQSYWHAIKAYCHSKLCNVLFTRELANRLE 221

  Fly   308 QRGISVFSLHPGNMVSSDLSRNYWFYRLLFAIVRPFTKSL----QQAAATSIYCATANELTGLSG 368
            ...::.:.|||| ::|:::.|.....:.|..:  |.:|..    :..|.|::|||....|..|||
Zfish   222 GTSVTCYCLHPG-VISTEIGRYMGPLQKLLCL--PMSKLFFLDPEAGAQTTLYCALQEGLEPLSG 283

  Fly   369 LYFNNCFFCEPSKLSKSAALQQQLWKLSENL 399
            .||::|...|...|.:..||.::||.:||.|
Zfish   284 RYFSSCALQEVGALGRDDALARKLWDVSERL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 109/291 (37%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 108/289 (37%)
dhrs13a.3NP_001007425.2 SDR 36..311 CDD:330230 105/284 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.