DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and rdh12

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001002325.1 Gene:rdh12 / 436597 ZFINID:ZDB-GENE-040718-9 Length:319 Species:Danio rerio


Alignment Length:299 Identity:117/299 - (39%)
Similarity:161/299 - (53%) Gaps:21/299 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SCSTALQVLHGKDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERP 170
            ||.:.::      |.|:.||:||||.|||.|||..||..|..:|.|||:...||.|...|.....
Zfish    33 SCRSTVR------LDGKVALVTGANSGIGKETALDLASRGARVILACRDLEKAEEAAAEIRTRVG 91

  Fly   171 AARSRCRFAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSH 235
            .|:...|  .|||:...|::.|.:...:.|.|:..||.||||...||.:|.||.|....|:||.|
Zfish    92 GAKVEVR--ELDLADCCSIRAFAQRFLREVDHLHILINNAGVMMCPYMKTADGFEMQIGVNHLGH 154

  Fly   236 FYLTLQLETLF--DYKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLF 298
            :.||..|..|.  ...:||:|:||.:|.|..:...:|  |...    .|.|.:||..:||.||||
Zfish   155 YLLTYLLIGLLKRSAPSRIVVVSSLAHNFGWIRFHDL--HSQG----SYNSGLAYCQSKLANVLF 213

  Fly   299 AQELAQRWKQRGISVFSLHPGNMVSSDLSRNYWFYRLLFAIVRPFTKSLQQAAATSIYCATANEL 363
            .:|||:|.:...::|.|:|||. |.|:|.|:.....||||....|.||.::.|.||||||.|.||
Zfish   214 TRELARRLQGSNVTVNSVHPGT-VRSELVRHSTLMSLLFAFFSMFLKSPKEGAQTSIYCAVAEEL 277

  Fly   364 TGLSGLYFNNC--FFCEPSKLSKSAALQQQLWKLSENLI 400
            ..:||.:|::|  .|..|...|:..|  ::||.:|..|:
Zfish   278 QSISGKHFSDCAPAFVAPQGRSEETA--RKLWDVSCELL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 117/299 (39%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 114/284 (40%)
rdh12NP_001002325.1 PRK06197 41..318 CDD:235737 114/285 (40%)
NADB_Rossmann 42..310 CDD:304358 112/278 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.