DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and sro

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster


Alignment Length:283 Identity:69/283 - (24%)
Similarity:105/283 - (37%) Gaps:56/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LITGANCGIGYETARSLAHHGCE--IIFACRN-RSSAEAAIERIAQERPAARSRCRFAALDL--- 183
            ||||.:.|:|:..| ...|....  :|..|.| :|.....::.:|..:... ||.....|||   
  Fly    30 LITGCDSGLGHSMA-VYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGL-SRMHTLELDLLEP 92

  Fly   184 SSLRSVQRFVEEI--KQSVSHIDYLILNAGV--FALPYTRTVDGLETTFQVSHLSHFYLTLQLET 244
            .|:|.|.|.:.:|  |.....:..||.||||  |.....:..:.:|.....:.|....||.:|..
  Fly    93 DSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIEAQINCNLLGTMRLTHELLP 157

  Fly   245 LF-DYKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWKQ 308
            |. ..:.|||.::|.....| ||.  |..:..|....::|:               ..|....:|
  Fly   158 LLRQQQGRIINVTSHCGLQA-LPA--LGPYAASKAALRFWT---------------DSLRVELQQ 204

  Fly   309 RGISVFSLHPGNMVSSDLSRNYWFYRLLFAIVRPFTKSLQQAAATSIYCATANELTGLSGLYFN- 372
            .|:.|.:..||:.|   |..|              ..:.||..|..:..|.:.|...|...||. 
  Fly   205 YGMEVVNFIPGSFV---LDSN--------------IAARQQQHAQKMREAFSAEQHALYDTYFEA 252

  Fly   373 -NCF------FCEPSKLSKSAAL 388
             |.:      |..|::|...:.|
  Fly   253 FNGYLKVLSGFKPPNRLRNESLL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 69/283 (24%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 69/283 (24%)
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 69/283 (24%)
adh_short 28..229 CDD:278532 57/235 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447508
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.