DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and CG7675

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster


Alignment Length:328 Identity:113/328 - (34%)
Similarity:179/328 - (54%) Gaps:32/328 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NVAQVRQRFDSCSTALQVLHGK-----DLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNR 155
            :||.:.....|....|::..|:     .:.|:|.:|||||.|||.|||:.||..|..||.||||.
  Fly    22 SVAAIVATLMSIRFYLRITAGRCFTETKMEGKTVIITGANSGIGKETAKDLAGRGARIIMACRNL 86

  Fly   156 SSAEAAIERIAQERPAARSRCRFAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPY--T 218
            .:|.|..:.|.:|  ...::.....|||.|.:||:.|..:|.::...||.||.|||: ||.:  .
  Fly    87 ETANAVKDEIVKE--TKNNKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGM-ALAFRGQ 148

  Fly   219 RTVDGLETTFQVSHLSHFYLT-LQLETL-FDYKTRIIVLSSESHRFANLPVENLA-VHHLSPPPE 280
            .:.||:|.|...:|...|.|| |.::.| .....||::::||.:|.:::   ||| ::.:...|.
  Fly   149 TSEDGVELTMATNHYGPFLLTHLLIDVLKKSAPARIVIVASELYRLSSV---NLAKLNPIGTFPA 210

  Fly   281 KYWSMMAYNNAKLCNVLFAQELAQRWKQRGISVFSLHPGNMVSSDLSRNYWFYRLL--FAIVRPF 343
            .|    .|..:|..|:.||:|||:|.:...::|..|||| |:.|.:.||..|...|  .||.:.|
  Fly   211 AY----LYYVSKFANIYFARELAKRLEGTKVTVNFLHPG-MIDSGIWRNVPFPLNLPMMAITKGF 270

  Fly   344 TKSLQQAAATSIYCATANELTGLSGLYFNNCFFCEPSKLSKSAALQQQ----LWKLSENLIAELV 404
            .|:.:..|.|:||.||:||:..:||.||.:   |:.:.|: :|||.::    :|:.|..:: :|.
  Fly   271 FKTTKAGAQTTIYLATSNEVANVSGKYFMD---CKEATLN-AAALDEEKGLKIWEESVKIV-KLT 330

  Fly   405 EQE 407
            .|:
  Fly   331 PQD 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 109/313 (35%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 106/291 (36%)
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 106/289 (37%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 104/282 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
76.860

Return to query results.
Submit another query.