DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and dhrs13l1

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_991211.1 Gene:dhrs13l1 / 402945 ZFINID:ZDB-GENE-040426-1907 Length:318 Species:Danio rerio


Alignment Length:290 Identity:98/290 - (33%)
Similarity:157/290 - (54%) Gaps:17/290 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDL 183
            |:|:|.::||.|.|||..||.:||..|..:|.|||::...|.|.:.|..|  :......|..|||
Zfish    33 LYGKTVIVTGGNTGIGKATATALAVRGARVILACRSKQKGEEAAKEIRTE--SGNDDVIFMQLDL 95

  Fly   184 SSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLT-LQLETLFD 247
            :|.:|::.|.|...::...:|.||.|||:.|.  .||.||:.....|:|:..|.|| |.||.|.:
Zfish    96 ASQKSIRSFAETFLKTEPRLDLLINNAGLAAA--GRTEDGIGMILGVNHIGPFLLTNLLLERLKE 158

  Fly   248 -YKTRIIVLSSESHRFANLPVENLAVHHL----SPPPEKYWSMMAYNNAKLCNVLFAQELAQRWK 307
             ..:|::.:||..|....:..:.:..|..    |...:.:   .||.::|||||||..|||:|.:
Zfish   159 CAPSRVVNVSSCGHDLGTIDFDCINTHKKLGLGSSDGDLF---RAYTHSKLCNVLFTHELAKRLE 220

  Fly   308 QRGISVFSLHPGNMVSSDLSRNY--WFYRLLFAIV-RPFTKSLQQAAATSIYCATANELTGLSGL 369
            ...::.:|||||: |.|:|.|:.  |..|:|..:| :.|.......|.|::||:..:.:..|||.
Zfish   221 GTNVTCYSLHPGS-VRSELGRDITEWHARVLLTVVSKFFATDPVSGAQTTLYCSLQDGIEHLSGR 284

  Fly   370 YFNNCFFCEPSKLSKSAALQQQLWKLSENL 399
            ||::|...:....::...:.::||::||.|
Zfish   285 YFSDCQLVQVKAEARDDGVAKKLWEVSEKL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 98/290 (34%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 97/288 (34%)
dhrs13l1NP_991211.1 PRK06197 35..316 CDD:235737 97/288 (34%)
NADB_Rossmann 35..311 CDD:304358 94/283 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.