DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and dhrs13

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_989311.1 Gene:dhrs13 / 394935 XenbaseID:XB-GENE-1006231 Length:314 Species:Xenopus tropicalis


Alignment Length:285 Identity:99/285 - (34%)
Similarity:155/285 - (54%) Gaps:13/285 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDL 183
            |.|:|.::||||.|||..||..:|..|..:|.|||.:.:.|||...|  .:.:..::..|..|||
 Frog    34 LKGKTVIVTGANVGIGKMTALDMAKRGARVILACRVKETGEAAAYDI--RKLSGNNQVVFMKLDL 96

  Fly   184 SSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLTLQLETLFDY 248
            :||.||:.|......|...:|.||.|||:..  :.:|.:|....|.|:||.||.||..|......
 Frog    97 ASLESVRSFCRAFLSSEPRLDILINNAGLSG--FGKTAEGYNIVFGVNHLGHFLLTSLLLDRLKQ 159

  Fly   249 KT--RIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWKQRGI 311
            .|  ||:||:|.:|.:..:....::|    |......::.:|.::||||||||:|||.|.:...:
 Frog   160 STPSRIVVLASYAHEWGKIDFNKISV----PSEHVKDTLQSYCDSKLCNVLFARELANRLQGTSV 220

  Fly   312 SVFSLHPGNMVSSDLSRNY--WFYRLLFAIVRPFTKSLQQAAATSIYCATANELTGLSGLYFNNC 374
            :.:|:|||. |.::|:|:.  |...|:..:...|.::....|.||||||....:...||.||:||
 Frog   221 TCYSVHPGT-VHTNLARSLPSWIKVLIEPVSWLFLRTPMNGAQTSIYCAVQEGIEMYSGRYFDNC 284

  Fly   375 FFCEPSKLSKSAALQQQLWKLSENL 399
            ...:....::..|:.::||::||.:
 Frog   285 QVRQVKPHARDDAVAKKLWEVSERM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 99/285 (35%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 98/283 (35%)
dhrs13NP_989311.1 NADB_Rossmann 36..306 CDD:389744 96/278 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.