DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and cbr1

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_919387.1 Gene:cbr1 / 373866 ZFINID:ZDB-GENE-030902-2 Length:276 Species:Danio rerio


Alignment Length:278 Identity:60/278 - (21%)
Similarity:105/278 - (37%) Gaps:69/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RTALITGANCGIGYETARSLA-HHGCEIIFACRNRSSAEAAIERIAQE--RPAARSRCRFAALDL 183
            :.||:||||.|||:...|:|. .:..::..:.|:.....||::.:.:|  .|.      |..||:
Zfish     5 KVALVTGANKGIGFAIVRALCKEYTGDVYLSSRDVGRGTAAVDSLKKEGLHPL------FHQLDI 63

  Fly   184 SSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLTLQLETLFDY 248
            :...||:...:..::....:|.||.|||:.......|..|  |...|:..::|:.|..:..:|  
Zfish    64 NDPNSVRTARDFFQEKYGGLDVLINNAGIAFKMADTTPFG--TQADVTLKTNFFATRDMCNVF-- 124

  Fly   249 KTRIIVLSSESHRFANLP--VENLAVHHLSPP-------------------------------PE 280
                :.:.....|..|:.  :.::|:...||.                               .|
Zfish   125 ----LPIIKPGGRLVNVSSGMGSMALGRCSPELQARFRSDDITEEELNGLMERFVREAQEGVHSE 185

  Fly   281 KYWSMMAYNNAK----LCNVLFAQELAQRWKQRGISVFSLHPGNMVSSDLSRNYWFYRLLFAIVR 341
            :.|...||..:|    ....:.|:.|.:.....||...:..|| .|.:|::             .
Zfish   186 RGWPSTAYGISKTGLTTLTRIQARNLTKERPGDGILCNACCPG-WVRTDMA-------------G 236

  Fly   342 P-FTKSLQQAAATSIYCA 358
            | .|||..:.|.|.:|.|
Zfish   237 PNATKSPDEGAITPVYLA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 60/278 (22%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 60/278 (22%)
cbr1NP_919387.1 carb_red_PTCR-like_SDR_c 5..276 CDD:187585 60/278 (22%)
adh_short 5..237 CDD:278532 52/259 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.