DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and CG8888

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:282 Identity:53/282 - (18%)
Similarity:91/282 - (32%) Gaps:95/282 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSS 185
            |:..||||....:.:..|:.|...|. .::|..|....|:...:|.:|  ....|.:...||::|
  Fly    95 GKGVLITGCEAPLAWYLAKKLDDLGF-TVYAGFNTPIEESDEAKILKE--VTSGRMKLLHLDVTS 156

  Fly   186 LRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLTLQLETL----- 245
            .:::......:.|.:.|                    |.|..:.|.|.:|:....:||.:     
  Fly   157 EKTILEAARYVSQHLPH--------------------GAEGLWSVVHCAHWIALGELEWIPFAVL 201

  Fly   246 ---FDYKT-------------------RIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAY 288
               .|...                   |::.|:|..:|..: ||..:              ..|.
  Fly   202 RKSLDLNLLGSARLTQIFLPLVRRAHGRVVFLTSGLNRVPS-PVRGI--------------QCAT 251

  Fly   289 NNAKLCNVLFAQELAQRWKQRGISVFSLHPG----------------------NMVSSDLSRNYW 331
            ..|..|   ||..|.|..:.||:.|..:..|                      |.:||:..:.|.
  Fly   252 QAAVDC---FAACLRQEMRTRGVDVSVVAAGEFAPGNGWLNETELRDQAKQMWNQLSSEQKKTYG 313

  Fly   332 --FYRLLFAIVRPFTKSLQQAA 351
              :|......|..:::   |||
  Fly   314 EDYYEAAMTSVEKYSR---QAA 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 53/282 (19%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 53/282 (19%)
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 52/281 (19%)
adh_short 96..293 CDD:278532 43/237 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447600
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.