DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and CG2064

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster


Alignment Length:292 Identity:110/292 - (37%)
Similarity:164/292 - (56%) Gaps:25/292 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 DLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALD 182
            |..|:..::||||.|||.|||..:|..|..:..|||:.:..|.|.:.|.:|........|  .||
  Fly    40 DETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIFSR--ELD 102

  Fly   183 LSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLT-LQLETLF 246
            ||||.|:::||:..|:....:..||.||||...|.|.|.||.|....|:|:.||.|| |.|:.|.
  Fly   103 LSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNLLLDVLK 167

  Fly   247 D-YKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWKQRG 310
            : ..:||:|:||.:|...::.|.:|      ...:.|...:||:.:||.||||.:|||:|.:..|
  Fly   168 NSAPSRIVVVSSLAHARGSINVADL------NSEKSYDEGLAYSQSKLANVLFTRELAKRLEGSG 226

  Fly   311 ISVFSLHPGNMVSSDLSRNYWFYR------LLFAIVRPFTKSLQQAAATSIYCATANELTGLSGL 369
            ::|.:|||| :|.::|:||:.|::      .|..::.|..|:.:..|.||||.|...||..:|||
  Fly   227 VTVNALHPG-VVDTELARNWAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYAALDPELKNISGL 290

  Fly   370 YFNNCFFCEPSKLSKSAALQQQ----LWKLSE 397
            ||::   |:|..:: |.||..:    ||..||
  Fly   291 YFSD---CKPKPVA-SGALDDKVAKFLWAESE 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 110/292 (38%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 109/289 (38%)
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 110/292 (38%)
NADB_Rossmann 43..317 CDD:304358 107/286 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447711
Domainoid 1 1.000 60 1.000 Domainoid score I2553
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
98.790

Return to query results.
Submit another query.