DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and CG2070

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster


Alignment Length:290 Identity:108/290 - (37%)
Similarity:153/290 - (52%) Gaps:27/290 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFA-ALDLS 184
            ||.|::||.|.|||.||...||..|..:..|||:....|.|...|.:   |..::..|| .|||.
  Fly    43 GRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREIIK---ATNNQNIFARQLDLC 104

  Fly   185 SLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLTLQLETLF--D 247
            |::|::.|....|:..:.:..||.|||:...|...|.||.|....|:|:.||.|||.|..:.  .
  Fly   105 SMKSIRNFAAGFKREQNKLHILINNAGIMDCPKMLTEDGFEMQIGVNHMGHFLLTLLLLDVLKSS 169

  Fly   248 YKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWKQRGIS 312
            ..:|::||||.:|||..:..::|      ...:.|...|||..:||.||||.:|||:|....|::
  Fly   170 APSRVVVLSSIAHRFGRIKRDDL------NSEKSYDRKMAYCQSKLANVLFTRELAKRLSGTGVT 228

  Fly   313 VFSLHPGNMVSSDLSRN-----YWFYRLLFA-IVRPFTKSLQQAAATSIYCATANELTGLSGLYF 371
            |.:|||| :|:::|.||     .||.:||.| |:..|.|:.:..|.|::|.|....|..:||.||
  Fly   229 VNALHPG-VVNTELFRNTPFLGSWFGKLLIAPIIWIFIKTARNGAQTTLYAALDPSLEKVSGRYF 292

  Fly   372 NNCFFCEPSKLSKSAAL----QQQLWKLSE 397
            ::|    ..|...|||.    .|.||..||
  Fly   293 SDC----KQKHVGSAAQYDDDAQFLWAESE 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 108/290 (37%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 108/290 (37%)
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 108/290 (37%)
NADB_Rossmann 43..317 CDD:304358 106/287 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447712
Domainoid 1 1.000 60 1.000 Domainoid score I2553
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
98.790

Return to query results.
Submit another query.