DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and CG9265

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster


Alignment Length:125 Identity:39/125 - (31%)
Similarity:61/125 - (48%) Gaps:6/125 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAAL 181
            |:|:...|||||...|:|...|..|...|.:::....|:......:: |.:|   |...|:...:
  Fly    82 KELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQ-IVEE---AGGYCKGYVV 142

  Fly   182 DLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFA-LPYTRTVDGL-ETTFQVSHLSHFYLT 239
            |:|....|.:..:.|:..|..|..||.||||.: |....|.|.| |.:|.|:.::||:.|
  Fly   143 DISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTT 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 39/125 (31%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 37/121 (31%)
CG9265NP_001260655.1 fabG 82..299 CDD:235546 39/125 (31%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 37/119 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.