DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and CG31809

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster


Alignment Length:263 Identity:55/263 - (20%)
Similarity:95/263 - (36%) Gaps:55/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSS 185
            |..|::|||..|||.|.||.||..|..::...|......|....|..:   ...:.::...|.:.
  Fly    48 GNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQ---YNVKIKWIVADFAK 109

  Fly   186 LRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSH-LSHFYLTLQLETLFDYK 249
            .|.|...:|:....: .:..|:.|.|        |:...|:..:||. :....||:.:.::....
  Fly   110 GREVYAHIEKELNGI-EVGILVNNVG--------TIHDPESLDKVSEDMLWDLLTVNVGSVTMLT 165

  Fly   250 TRII--VLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWKQRGIS 312
            .:|:  ::|.......||...:    .|.|.|    ::.||...|.....|.:.|.....:..|.
  Fly   166 RKILPQMISRRKGAIVNLGSSS----ELQPHP----NLTAYAATKKFVTHFTKGLEYEVAEHNIH 222

  Fly   313 VFSLHPG----NMVS-SDLSR---------------------------NYWFYRLLFAIVRPFTK 345
            |..:.|.    ||.| ||..|                           .:|.:.|.:|:::.|..
  Fly   223 VQLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYARSAVFTLGKTSETNGFWVHGLQYALMKLFPM 287

  Fly   346 SLQ 348
            .::
  Fly   288 EIR 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 55/263 (21%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 55/263 (21%)
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 54/257 (21%)
DltE 50..302 CDD:223377 54/261 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447678
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.