DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and Ldsdh1

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster


Alignment Length:263 Identity:55/263 - (20%)
Similarity:104/263 - (39%) Gaps:62/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 DLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFA-AL 181
            |::|:..||||...|:|.|.|...|..|..|:....|..:....::.|......|     |. ..
  Fly    55 DVNGKVVLITGTGHGMGKEMALQYAKLGATILCWDVNEQTNNQTVKEIKNNGGKA-----FGYVC 114

  Fly   182 DLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALP----YTRTVDGLETTFQVSHLSHFYLTLQL 242
            :::....:....:::::....|..::.|||:  :|    ...|.:.:...::::.||||::....
  Fly   115 NVTKREELIELAQKVRKEHGFIHVVVNNAGI--MPCHPLLEHTENEIRLMYEINVLSHFWIIQAF 177

  Fly   243 ETLFDYKTR----IIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFA---- 299
              |.|...|    |:.|||.:..|..:                       |....|...||    
  Fly   178 --LPDMIERNEGSIVALSSCAGLFGLI-----------------------NLVPYCGTKFAVRGY 217

  Fly   300 -----QELAQRWKQRGISVFSLHPGNMVSSDLSRN--YWF---YRLLFA------IVRPFTKSLQ 348
                 :||.|:..|..:.:.:::| .|:.:.|.:|  |.|   ::|:.|      |:....:.|:
  Fly   218 MAALVEELRQKNPQNNVKLTTIYP-YMIDTGLCKNPRYRFPNLFKLIPADVAAGSIIEAQRQGLE 281

  Fly   349 QAA 351
            :||
  Fly   282 EAA 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 55/263 (21%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 54/260 (21%)
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 43/221 (19%)
NADB_Rossmann 60..287 CDD:304358 53/258 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447650
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.