DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and spidey

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster


Alignment Length:221 Identity:46/221 - (20%)
Similarity:88/221 - (39%) Gaps:40/221 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSS 185
            |..|::||:..|||...|:.||..|.:::...|:........:.|..:...   ..|...:|.:.
  Fly    52 GEWAVVTGSTDGIGKAYAKELARRGLKLVLISRSLEKLNVVAKEIGDKYGV---EVRVIDVDFTG 113

  Fly   186 LRSVQRFVEEIKQSVSHIDYLILNAGV------FAL-------PYTRTVDGLETTFQVSHLSHFY 237
            ...:...:.| |.:..::..|:.|.|:      :.|       |:.|.:.. .....|:|::..:
  Fly   114 GDEIYDKIRE-KTTGLNVGVLVNNVGISYGHPEYFLDCYKADPPFLRNIVA-ANIHSVTHMTALF 176

  Fly   238 LTLQLETLFDYKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQEL 302
            |...:.   ..:..||.:||.:....|            |....|.|..|:.|.      |:.:|
  Fly   177 LPGMIS---QRRGVIINVSSTAGVIPN------------PLLSVYSSTKAFVNK------FSDDL 220

  Fly   303 AQRWKQRGISVFSLHPGNMVSSDLSR 328
            ...:|:.||.:.|:.|| .|::::|:
  Fly   221 QTEYKEHGILIQSVQPG-FVATNMSK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 46/221 (21%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 46/221 (21%)
spideyNP_572420.1 PLN02780 8..321 CDD:166421 46/221 (21%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 46/221 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447529
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.