DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and CG3842

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster


Alignment Length:294 Identity:102/294 - (34%)
Similarity:151/294 - (51%) Gaps:26/294 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAA----IERIAQERPAARSRCRFA 179
            :.|:..::||.|.|||.||...||..|..:..|||:....|||    ::|...::...|:     
  Fly    72 IDGKVVIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMDRSRNQQLFNRT----- 131

  Fly   180 ALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLT-LQLE 243
             |||.||:||:.|||..|...|.:|.||.||||.|.|.|.|.||.|..|.|:||.||.|| |.|:
  Fly   132 -LDLGSLQSVRNFVERFKAEESRLDILINNAGVMACPRTLTADGFEQQFGVNHLGHFLLTNLLLD 195

  Fly   244 TL-FDYKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMM--AYNNAKLCNVLFAQELAQR 305
            .| ....:||:|:||.:|.|..:..|:|.       .||.:|..  ||:.:||.|:||..:|:..
  Fly   196 RLKHSSPSRIVVVSSAAHLFGRINREDLM-------SEKNYSKFFGAYSQSKLANILFTLKLSTI 253

  Fly   306 WKQRGISVFSLHPGNMVSSDLSRNY----WFYRLLFAIVRPFTKSLQQAAATSIYCATANELTGL 366
            .|..|::|...||| :|.::::|::    |....|......|.|:.:..|.|.:..|...:|.|.
  Fly   254 LKDTGVTVNCCHPG-VVRTEINRHFSGPGWMKTALQKGSLYFFKTPKAGAQTQLRLALDPQLEGS 317

  Fly   367 SGLYFNNCFFCEPSKLSKSAALQQQLWKLSENLI 400
            :|.|:::|.........::......||:.||.|:
  Fly   318 TGGYYSDCMRWPLFPWVRNMQTADWLWRESEKLL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 102/294 (35%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 102/292 (35%)
CG3842NP_001259270.1 FabG 71..319 CDD:223959 94/260 (36%)
NADB_Rossmann 74..347 CDD:304358 99/286 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447713
Domainoid 1 1.000 60 1.000 Domainoid score I2553
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
98.790

Return to query results.
Submit another query.