DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and Rdh12

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001101507.1 Gene:Rdh12 / 314264 RGDID:1310462 Length:316 Species:Rattus norvegicus


Alignment Length:303 Identity:114/303 - (37%)
Similarity:165/303 - (54%) Gaps:31/303 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 CSTALQVLHGKDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPA 171
            |:|.:|:      .|:..:|||||.|||.||||.||..|..:..|||:....|:|...|..:  .
  Rat    31 CTTKVQI------PGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRAD--T 87

  Fly   172 ARSRCRFAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHF 236
            ..|:.....||||..:|::.|.|........:..||.||||...||::||||.||.|.|:||.||
  Rat    88 KNSQVLVRKLDLSDTKSIRTFAEGFLAEEKKLHILINNAGVMMCPYSKTVDGFETHFGVNHLGHF 152

  Fly   237 YLT-LQLETLFD-YKTRIIVLSSESH-----RFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLC 294
            .|| |.|..|.: ...|:|.|||.:|     ||.:|..:           ::|.|..||:::||.
  Rat   153 LLTYLLLGRLKESAPARVINLSSVAHLGGKIRFHDLQSK-----------KRYCSGFAYSHSKLA 206

  Fly   295 NVLFAQELAQRWKQRGISVFSLHPGNMVSSDLSRNYWFYRLLFAIVRPFTKSLQQAAATSIYCAT 359
            ||||.:|||:|.:..|::.:.:||| .|.|:::|:.:...||:.:..||.||..|.|.||::||.
  Rat   207 NVLFTRELAKRLQGTGVTAYVVHPG-CVLSEITRHSFLMCLLWRLFSPFFKSPWQGAQTSLHCAL 270

  Fly   360 ANELTGLSGLYFNNC--FFCEPSKLSKSAALQQQLWKLSENLI 400
            ...|..|||.||::|  .:..|...:|..|  ::||.:|..|:
  Rat   271 EEGLEPLSGKYFSDCKRTWVSPRARNKKTA--ERLWNVSCELL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 114/303 (38%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 111/289 (38%)
Rdh12NP_001101507.1 NADB_Rossmann 39..307 CDD:419666 109/283 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.