DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and CG3603

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster


Alignment Length:217 Identity:58/217 - (26%)
Similarity:91/217 - (41%) Gaps:49/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDL 183
            |.|:.||:|||..|||..|.|.||..|.::|...||..:|:..::.:..||.||      ..:|:
  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSAA------LEVDV 64

  Fly   184 SSLRSVQRFVEEIKQSVSHIDYLILN-AGVFALPYTRTVDGLETTFQVSHLSHFYLTLQLETLFD 247
            ||.:|||..|.|..:.......:::| ||:       |.||             ||....|..:|
  Fly    65 SSAQSVQFSVAEALKKFQQAPTIVVNSAGI-------TRDG-------------YLLKMPERDYD 109

  Fly   248 ------YKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMA-YNNAKLCN--------VL 297
                  .|...:|..:.:.......:||..:.:||       |::| .||....|        :.
  Fly   110 DVYGVNLKGTFLVTQAYAKAMIEQKLENGTIVNLS-------SIVAKMNNVGQANYAATKAGVIS 167

  Fly   298 FAQELAQRWKQRGISVFSLHPG 319
            |.:..::.:.:.||.|..:.||
  Fly   168 FTEVASKEFGKFGIRVNCILPG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 58/217 (27%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 57/215 (27%)
CG3603NP_001259199.1 fabG 6..248 CDD:235546 58/217 (27%)
BKR_SDR_c 9..248 CDD:187594 56/214 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447715
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.