DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and Dhrs13

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_038943561.1 Gene:Dhrs13 / 303275 RGDID:1305508 Length:375 Species:Rattus norvegicus


Alignment Length:293 Identity:108/293 - (36%)
Similarity:151/293 - (51%) Gaps:28/293 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDL 183
            |.||||::||||.|||..||..||..|..::.|||:|...|||...:.||  :..:...|.||||
  Rat    34 LRGRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQE--SGNNEVIFMALDL 96

  Fly   184 SSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLT-LQLETLFD 247
            :||.|||.|......|...:|.||.|||:.:...||....|  ..:|:|:..|.|| |.|..|..
  Rat    97 ASLTSVQAFATAFLSSEPRLDILIHNAGISSCGRTRETFNL--LLRVNHVGPFLLTHLLLPRLRS 159

  Fly   248 -YKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYW--SMMAYNNAKLCNVLFAQELAQRWKQR 309
             ..:|::::||.:||...|....|..      |...|  .:.||.::||.|||||:|||.:.:..
  Rat   160 CAPSRVVIVSSAAHRRGRLDFTRLDC------PVVGWQQELRAYADSKLANVLFARELATQLEGT 218

  Fly   310 GISVFSLHPGNMVSSDLSRNYWFYRLLFAIVRPFTKSL--------QQAAATSIYCATANELTGL 366
            |::.::.||| .|:|:|     |.|.|...:||..:.|        |..|.|.:|||....:..|
  Rat   219 GVTCYAAHPG-PVNSEL-----FLRHLPGWLRPILRPLAWLVLRAPQGGAQTPLYCALQEGIEPL 277

  Fly   367 SGLYFNNCFFCEPSKLSKSAALQQQLWKLSENL 399
            ||.||.||...|.|..::......:|||:::.|
  Rat   278 SGRYFANCHVEEVSAAARDDQAAHRLWKVTKKL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 108/293 (37%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 107/291 (37%)
Dhrs13XP_038943561.1 retinol-DH_like_SDR_c_like 36..304 CDD:212492 103/283 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.