DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and Dhrsx

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_006249055.1 Gene:Dhrsx / 288525 RGDID:1305017 Length:331 Species:Rattus norvegicus


Alignment Length:288 Identity:87/288 - (30%)
Similarity:126/288 - (43%) Gaps:30/288 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSSL 186
            |.|::|||..|:|..||..||..|..:|.|..:.......:.||.:|  :......|..|||:||
  Rat    42 RVAIVTGATRGVGLSTACQLARLGMRVIVAGNDEHRGHEVVARIQEE--SGPESAHFLFLDLASL 104

  Fly   187 RSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLT-LQLETL----- 245
            .||:.||...:.:...:..||.||||...|...|.||.|....|:.|.||.|| |.|..|     
  Rat   105 SSVRSFVRNFEATALPLHLLINNAGVMLDPSGNTKDGFERHVGVNFLGHFLLTSLLLPALRASGH 169

  Fly   246 FDYKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWKQRG 310
            ...|:|:|.:.|.:|......|..|...  ||.|   .::.||..:||...||:..|.:.....|
  Rat   170 QGRKSRVITVCSSTHWVGQADVARLLGQ--SPAP---CALAAYAGSKLALALFSLRLQRLLSALG 229

  Fly   311 --ISVFSLHPGNMVSSDLSRNYWFYR--------LLFAIVRPFTKSLQQAAATSIYCATANELTG 365
              ::...:.||.:.::..:...|..|        |||       |:..:.|.||:|.|.:.:|.|
  Rat   230 DPVTANIVDPGVVDTALFAHAGWGTRAVQRFLGWLLF-------KTPDEGAWTSVYAAASPKLEG 287

  Fly   366 LSGLYFNNCFFCEPSKLSKSAALQQQLW 393
            :.|.|..:....|....::...||..||
  Rat   288 IGGRYLRDEAEAEVLGAARDLELQGHLW 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 87/288 (30%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 87/288 (30%)
DhrsxXP_006249055.1 PRK06197 36..326 CDD:235737 87/288 (30%)
NADB_Rossmann 41..315 CDD:304358 85/286 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.