DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and SPAC19A8.06

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_593786.1 Gene:SPAC19A8.06 / 2542391 PomBaseID:SPAC19A8.06 Length:397 Species:Schizosaccharomyces pombe


Alignment Length:319 Identity:65/319 - (20%)
Similarity:135/319 - (42%) Gaps:32/319 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAAL 181
            :.::|...::||.:.|||......||..|.:::...|.... :..::.|...|...:::..:..:
pombe    71 RKMNGMVVMVTGGSSGIGQVVVEKLASLGAQVVILLRTEPD-QFTVDYIMDLRKRTKNQLIYTEV 134

  Fly   182 -DLSSLRSVQRFVEEIKQ--SVSHIDYLILNAGVFALPY---TRTVDGLETTFQVSHLSHFYLTL 240
             ||||:.||::|..:...  .:..:|.::|.:||...|:   ..|.:|:|..:..:.|..:.|..
pombe   135 CDLSSMLSVRKFATKWIDCTPIRRLDMIVLCSGVLLPPFMDRQTTEEGVELQWATNFLGPYQLLR 199

  Fly   241 QLETLF-----DYKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFA- 299
            .|..:.     ..:.||:..:..|:...|:...:|.:.:...|.:..|.::  .||||..:.:. 
pombe   200 ILRPVIYGQPGHREVRIVAATCSSYILGNIDFNDLDLSNHPYPRKSPWKVV--GNAKLALMTYLY 262

  Fly   300 --QELAQRWKQRGISVFSLH-----PGNMVSSDLSRNYWFYRL----LFAIVRPF----TKSLQQ 349
              |:.|:..::......:||     ||.:.:....|...|.::    |:.::.||    .|....
pombe   263 DFQKKAEAHERPDKMPCNLHTIMANPGVVRTPGFRRVVSFGKVWGLFLYLLLWPFWWLLLKGTIH 327

  Fly   350 AAATSIYCATANELTGLS-GLYFNNCFFCEPS-KLSKSAALQQQLWKLSENLIAELVEQ 406
            .|.:..:...:.|...:: .:..|.|...|.| |........::|.|.::..|.|:.:|
pombe   328 GAQSFFHAICSPEFASITQPVLVNECSIVEYSRKEITDPEFAEKLIKAADAQIDEVEKQ 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 63/313 (20%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 63/309 (20%)
SPAC19A8.06NP_593786.1 retinol-DH_like_SDR_c_like 75..372 CDD:212492 60/299 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.