DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and erg27

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_595440.1 Gene:erg27 / 2540195 PomBaseID:SPBC1709.07 Length:338 Species:Schizosaccharomyces pombe


Alignment Length:269 Identity:70/269 - (26%)
Similarity:108/269 - (40%) Gaps:70/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 ALITGANCGIGYETARSLAH----------HGCEIIFACRNRSSAEAAIERIAQERPAARSRCRF 178
            |||||:|.|:|:..|..|..          ....:|..||:|..||.|..|:.:..|..:.|..:
pombe     7 ALITGSNSGLGFGIATRLLQFYQPRLQDEPEVFTVILTCRSREKAEDACRRLKEFFPDRKIRLEY 71

  Fly   179 AALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALP------------------------YTR 219
            ..||||::.||:..|::|......:|::.||||.:.|.                        |..
pombe    72 VLLDLSNMASVEAAVQDIATRFPKLDFVYLNAGAWDLEGIQWLKAIFSTLINPIQALTHPTFYKE 136

  Fly   220 TV-----DGLETTFQVSHLSHFYLTLQLETL--FDYKTRIIVLSSESHRFANLPVENLAVHHLSP 277
            |.     |.|...|:.:...||||..:|..|  ....|::::.||......:|..|:|...|...
pombe   137 TAGRVSNDSLGYIFESNVFGHFYLKNRLAELKVLRSSTKVVLTSSLVAEKKSLDFEDLQCFHGEQ 201

  Fly   278 PPEKYWSMMAYNNAK-LCNVLFAQELAQRWKQRGI--SVFSLHPG----NMVSSDL--------S 327
            |         |.::| |.:||...||     ::|:  ..:.:|||    ||..:.|        .
pombe   202 P---------YQSSKRLLDVLHYAEL-----EKGLPFEQYLVHPGLCTTNMYETFLGPILVMCAK 252

  Fly   328 RNYWFYRLL 336
            ..::..|||
pombe   253 LGFYICRLL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 70/269 (26%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 70/269 (26%)
erg27NP_595440.1 3KS_SDR_c 4..290 CDD:187645 70/269 (26%)
FabG 4..>246 CDD:223959 67/252 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R408
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.