DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and Dhrsx

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001028498.2 Gene:Dhrsx / 236082 MGIID:2181510 Length:335 Species:Mus musculus


Alignment Length:287 Identity:91/287 - (31%)
Similarity:130/287 - (45%) Gaps:27/287 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSS 185
            ||.|::|||..|||..|||.||..|..::.|..:....:..:..|..|  ....|..|..|||:|
Mouse    43 GRVAIVTGATAGIGRSTARQLARLGMCVVVAGNDEHCGQEVVSSIRAE--MGSDRAHFLPLDLAS 105

  Fly   186 LRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLTLQLETLFDYK- 249
            |.||:.|..:.:.....:..|:.||||...|...|.||.|....|:.|.||.|||.|....... 
Mouse   106 LASVRGFARDFRALGLPLHLLVNNAGVMLEPRAETEDGFERHLGVNFLGHFLLTLLLLPALRASG 170

  Fly   250 -----TRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWKQR 309
                 :|::.:.|.:|....:.:.:|...|...|      ..||..:||...|||.:|.:....|
Mouse   171 AEGRGSRVVTVGSATHYVGTVDMADLHGRHAYSP------YAAYAQSKLALALFALQLQRILDAR 229

  Fly   310 GISVFS--LHPGNMVSSDLSRNY-WFYRLLFAIVRPFT-----KSLQQAAATSIYCATANELTGL 366
            |..|.|  ..|| :|.::|.|:. |..|    .|:.|.     ||.::.|.|.:|.|.|.||.|:
Mouse   230 GDPVTSNMADPG-VVDTELYRHAGWVLR----TVKRFLGWLVFKSPEEGAWTLVYAAAAPELEGV 289

  Fly   367 SGLYFNNCFFCEPSKLSKSAALQQQLW 393
            .|.|..:....||...::...||::||
Mouse   290 GGRYLRDEAEAEPLGTARDQELQRRLW 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 91/287 (32%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 91/287 (32%)
DhrsxNP_001028498.2 PRK06197 38..324 CDD:235737 91/287 (32%)
retinol-DH_like_SDR_c_like 43..316 CDD:212492 89/285 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.