DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and DHRSX

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_660160.2 Gene:DHRSX / 207063 HGNCID:18399 Length:330 Species:Homo sapiens


Alignment Length:292 Identity:96/292 - (32%)
Similarity:146/292 - (50%) Gaps:33/292 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSSL 186
            |.|::||...||||.||:.||..|..:|.|..|.|.|:..:.:|.:|  ....:..|...||:|:
Human    44 RVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEE--TLNDKVEFLYCDLASM 106

  Fly   187 RSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLT-LQLETLFD--- 247
            .|:::||::.|.....:..||.||||..:|..:|.||.|..|.:::|.||.|| |.|:||.:   
Human   107 TSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGS 171

  Fly   248 --YKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWKQRG 310
              :..|::.:||.:|..|.|.:::|.......|      ..||..:||..|||...|.:.....|
Human   172 PGHSARVVTVSSATHYVAELNMDDLQSSACYSP------HAAYAQSKLALVLFTYHLQRLLAAEG 230

  Fly   311 ISVFS--LHPGNMVSSDLSRN-YWFYR--------LLFAIVRPFTKSLQQAAATSIYCATANELT 364
            ..|.:  :.|| :|::|:.:: :|..|        |||       |:..:.|.||||.|...||.
Human   231 SHVTANVVDPG-VVNTDVYKHVFWATRLAKKLLGWLLF-------KTPDEGAWTSIYAAVTPELE 287

  Fly   365 GLSGLYFNNCFFCEPSKLSKSAALQQQLWKLS 396
            |:.|.|..|....:...::.:..||||||..|
Human   288 GVGGHYLYNEKETKSLHVTYNQKLQQQLWSKS 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 96/292 (33%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 96/292 (33%)
DHRSXNP_660160.2 PRK06197 39..325 CDD:235737 96/292 (33%)
retinol-DH_like_SDR_c_like 43..316 CDD:212492 93/287 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.