DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and DC2.5

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_503155.4 Gene:DC2.5 / 183970 WormBaseID:WBGene00017082 Length:337 Species:Caenorhabditis elegans


Alignment Length:312 Identity:110/312 - (35%)
Similarity:169/312 - (54%) Gaps:16/312 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 QRFDSCSTALQVLHGKDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIA 166
            ::|.|.:.||:|:.|.||.|:|..|||...|:|.||||:....|..|:...||.:::|...:.:.
 Worm    26 RKFHSRTNALEVVRGIDLSGKTYAITGTTSGVGTETARAFILKGAHIVMINRNYAASETLKQSLL 90

  Fly   167 QERPAAR---SRCRFAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTF 228
            .|.|.||   .:|     |||||.||::..||.......:..|||||||.......|.|..|..|
 Worm    91 CETPDARIDIVQC-----DLSSLASVKKTAEEYLTKKWPLHGLILNAGVLGRKEKTTADRFEAHF 150

  Fly   229 QVSHLSHFYLTLQLETLF--DYKTRIIVLSSESHRFANLPVENLAVHHLS---PPPEKYWSMMAY 288
            .::||:||.|..:|..:.  ...:||::|||...:|.::..::.....|.   |.....|....|
 Worm   151 GINHLAHFLLIKELLPVLRSSAPSRIVILSSTLSKFTSINPDSKIEEKLGTLCPKNATEWYYRLY 215

  Fly   289 NNAKLCNVLFAQELAQRWKQRGISVFSLHPGNMVSSDLSRNYWFYRLLFAIVRPFTKSLQQAAAT 353
            ..:|:||:|.|.:|.:...:.||||:|:|||:.|.::|.|:..|:.:...:..||||:..|.|||
 Worm   216 AKSKMCNMLIAFKLHRDEFENGISVYSVHPGSAVRTNLHRDVPFWSIFNFLSIPFTKNASQGAAT 280

  Fly   354 SIYCATANELTGLSGLYFNNCFFCE---PSKLSKSAALQQQLWKLSENLIAE 402
            |:|||...|:..|||.|:.:|:..|   ..|:::...||:.||:.||.|:.:
 Worm   281 SLYCAVHPEVQELSGRYWESCWDDELNLDEKVARDEELQEALWEYSEELVGK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 110/308 (36%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 102/291 (35%)
DC2.5NP_503155.4 PRK06196 28..331 CDD:235736 110/307 (36%)
retinol-DH_like_SDR_c_like 45..323 CDD:212492 97/282 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I4798
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56334
Inparanoid 1 1.050 174 1.000 Inparanoid score I2710
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48603
OrthoDB 1 1.010 - - D1413827at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm14313
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.