DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and dhs-17

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001041109.1 Gene:dhs-17 / 178990 WormBaseID:WBGene00000980 Length:286 Species:Caenorhabditis elegans


Alignment Length:307 Identity:84/307 - (27%)
Similarity:131/307 - (42%) Gaps:56/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RTALITGANCGIGYETARSLAHHGCE-IIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSS 185
            ||.|||||..|||.:||..||.|... :|...|......|..:.|.:|.... |...:.|.|.:.
 Worm     8 RTILITGATDGIGKQTALDLAAHPDNFVIIHGRTEEKCIATKDWIGKENGNC-SNIDYVAGDFAV 71

  Fly   186 LRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYL-TLQLETLFDYK 249
            |:.|....||:::....::.|:.||||.......|.||:|:||||::|:|:.| .|.|..|...:
 Worm    72 LKEVAIIAEEVERRFPELNVLLCNAGVLYPRRLETKDGMESTFQVNYLAHYLLCNLLLPVLSHNR 136

  Fly   250 TRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRW----KQRG 310
            :.:||:.|..|.:.:|...::..      .::|...:.|:.:||...|.|..|.:|.    :...
 Worm   137 SNVIVVGSVLHTWPSLDWADVMA------TKEYEKYLQYSRSKLMCHLMAFALHRRMNIARQHVN 195

  Fly   311 ISVFSL----HPGNMVSSDLSRNYWFYRLLFAIVRPFTKSLQQAAATSIYCATANELTGL----- 366
            :::..|    .|.|  :..|..               |.:|..:.:|...|..|..|..|     
 Worm   196 VNIIELGKEKEPNN--NGKLRT---------------TSALSSSMSTLSICRQAGNLAQLIEGPC 243

  Fly   367 ----SGLYFNNCFFCEPS-KLSKSAA------LQQQLWKLSENLIAE 402
                ||.|.      :|| |..:|.:      ||::||..|:.|..|
 Worm   244 LEKISGKYL------DPSGKQMRSGSDATDERLQERLWAYSKELCHE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 83/305 (27%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 83/305 (27%)
dhs-17NP_001041109.1 retinol-DH_like_SDR_c_like 7..275 CDD:212492 79/296 (27%)
PRK06197 8..281 CDD:235737 82/302 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.