DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and C27D8.4

DIOPT Version :10

Sequence 1:NP_609171.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_502425.2 Gene:C27D8.4 / 178223 WormBaseID:WBGene00007780 Length:338 Species:Caenorhabditis elegans


Alignment Length:112 Identity:22/112 - (19%)
Similarity:37/112 - (33%) Gaps:51/112 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 IEECTRQIIFVTPCR--AILGWSTSQNAL------------------------------RVYYHQ 526
            :.:|.::.|.|.|.:  |:|.::..|:|:                              ::..|.
 Worm   192 LSDCAKKGIAVKPKKGNALLFFNLQQDAIPDPFSLHGGCPVIEGEKWSATKWIHVDSFDKILTHD 256

  Fly   527 GECVTLNMRDTGDRDEQLEVIERLRAVTNGCGALELSLRRNPMGQLG 573
            |.|..:|           |..||. ||...||       :||...:|
 Worm   257 GNCTDVN-----------ESCERW-AVLGECG-------KNPEYMVG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_609171.1 WW 13..43 CDD:197736
human_WWOX_like_SDR_c-like 121..402 CDD:187669
C27D8.4NP_502425.2 Rossmann-fold NAD(P)(+)-binding proteins 80..313 CDD:473865 22/112 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.