DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and Rdh11

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_067532.2 Gene:Rdh11 / 17252 MGIID:102581 Length:316 Species:Mus musculus


Alignment Length:312 Identity:112/312 - (35%)
Similarity:170/312 - (54%) Gaps:31/312 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 QVRQRFDS--CSTALQVLHGKDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAA 161
            ::|:...|  |::.:|      |.|:.|::||||.|||.|||:.||..|..:..|||:....|.|
Mouse    20 KIRKMLSSGVCTSNVQ------LPGKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDKGELA 78

  Fly   162 IERIAQERPAARSRCRFAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLET 226
            ...|  :.....|:.....|||:..:|::.|.::......|:..||.||||...||::|.||.|.
Mouse    79 AREI--QAVTGNSQVFVRKLDLADTKSIRAFAKDFLAEEKHLHLLINNAGVMMCPYSKTADGFEM 141

  Fly   227 TFQVSHLSHFYLT-LQLETLFD-YKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSM-MAY 288
            ...|:||.||.|| |.||.|.: ..:||:.|||..|....:...||       ..||::|. :||
Mouse   142 HIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGRIHFHNL-------QGEKFYSAGLAY 199

  Fly   289 NNAKLCNVLFAQELAQRWKQRGISVFSLHPGNMVSSDLSRNY-----WFYRLLFAIVRPFTKSLQ 348
            .::||.|:||.:|||:|.|..|::.:|:|||. |.|:|:| |     |.::|.|.    |.|:.|
Mouse   200 CHSKLANILFTKELAKRLKGSGVTTYSVHPGT-VHSELTR-YSSIMRWLWQLFFV----FIKTPQ 258

  Fly   349 QAAATSIYCATANELTGLSGLYFNNCFFCEPSKLSKSAALQQQLWKLSENLI 400
            :.|.||:|||....|..|||.:|::|.....|...::..:.::||.:|.:|:
Mouse   259 EGAQTSLYCALTEGLESLSGSHFSDCQLAWVSYQGRNEIIARRLWDVSCDLL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 111/307 (36%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 107/288 (37%)
Rdh11NP_067532.2 PRK06197 38..311 CDD:235737 107/288 (37%)
NADB_Rossmann 38..306 CDD:304358 105/282 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.