DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and Hsd17b7

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_011237060.1 Gene:Hsd17b7 / 15490 MGIID:1330808 Length:377 Species:Mus musculus


Alignment Length:341 Identity:93/341 - (27%)
Similarity:134/341 - (39%) Gaps:101/341 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RTALITGANCGIGYE-TARSLAH----HGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAAL 181
            :..|||||:.|||.. ..|.||.    |.|   .||||.|.|.|..:.:....|:|  ......:
Mouse     3 KVVLITGASSGIGLALCGRLLAEDDDLHLC---LACRNLSKARAVRDTLLASHPSA--EVSIVQM 62

  Fly   182 DLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALP-----------YTR---------------- 219
            |:|||:||.|..||:||....:|||.||||:...|           ::|                
Mouse    63 DVSSLQSVVRGAEEVKQKFQRLDYLYLNAGILPNPQFNLKAFFCGIFSRNVIHMFTTAEGILTQN 127

  Fly   220 ---TVDGLETTFQVSHLSHFYLTLQLETLF---DYKTRIIVLSSESHRFANLPVENLAVHHLSPP 278
               |.|||:..|:.:...||.|..:||.|.   |..:::|..||.:.:.||..:|::. |...|.
Mouse   128 DSVTADGLQEVFETNLFGHFILIRELEPLLCHADNPSQLIWTSSRNAKKANFSLEDIQ-HSKGPE 191

  Fly   279 PEKYWSMMAYNNAKLCNVLFAQELAQRWKQRGISVFSLHPG----NMVSSDLSRNYW------FY 333
            |        |:::|....|....|.:.:.|:|:....:.||    ||....|....|      .:
Mouse   192 P--------YSSSKYATDLLNVALNRNFNQKGLYSSVMCPGVVMTNMTYGILPPFIWTLLLPIMW 248

  Fly   334 RLLFAI------------------------VRPFTKSLQQAAATSIYCATANELTG--------L 366
            .|.|.:                        :.|.||   .|:|||.:  ..|.:||        |
Mouse   249 LLRFFVNALTVTPYNGAEALVWLFHQKPESLNPLTK---YASATSGF--GTNYVTGQKVHNPLML 308

  Fly   367 SGLYFNN--CFFCEPS 380
            |.:.|.|  .:...||
Mouse   309 SSVMFTNPSAWLLHPS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 93/341 (27%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 93/341 (27%)
Hsd17b7XP_011237060.1 3KS_SDR_c 2..280 CDD:187645 77/290 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R408
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.