DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and Cbr3

DIOPT Version :10

Sequence 1:NP_609171.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_766635.1 Gene:Cbr3 / 109857 MGIID:1309992 Length:277 Species:Mus musculus


Alignment Length:288 Identity:60/288 - (20%)
Similarity:115/288 - (39%) Gaps:70/288 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SCSTALQVLHGKDLHGRTALITGANCGIGYETARSLAH-HGCEIIFACRNRSSAEAAIERIAQER 169
            |||             |.||:||||.|||:...|.|.. ...:::...|:.:...||::::..|.
Mouse     3 SCS-------------RVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVQQLQAEG 54

  Fly   170 PAARSRCRFAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGV-FALPYTRTVD-GLETTFQVSH 232
            .:.    ||..||:...:|::...:.:::....::.|:.|||: |.:......| ..|.|.:.:.
Mouse    55 LSP----RFHQLDIDDPQSIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTPFDIQAEVTLKTNF 115

  Fly   233 LSHFYLTLQLETLFDYKTRIIVLSS---------------ESHRFANLPVENLA----------- 271
            .:...:..:|..:.....|::.:||               |..|...|...:|.           
Mouse   116 FATRNVCTELLPIMKPHGRVVNISSLQGLKALENCREDLQEKFRCDTLTEVDLVDLMKKFVEDTK 180

  Fly   272 --VHHLSPPPEKYWSMMAYNNAKL----CNVLFAQELAQRWKQRGISVFSLHPGNMVSSDLSRNY 330
              ||.     .:.|...||..:||    ...:.|::|.::.|...|.:.:..|| .|.:|::|:.
Mouse   181 NEVHE-----REGWPDSAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPG-WVKTDMARDQ 239

  Fly   331 WFYRLLFAIVRPFTKSLQQAAATSIYCA 358
            .            ::::::.|.|.:|.|
Mouse   240 G------------SRTVEEGAETPVYLA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_609171.1 WW 13..43 CDD:197736
human_WWOX_like_SDR_c-like 121..402 CDD:187669 57/273 (21%)
Cbr3NP_766635.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 57/272 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.