DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and Rdh13

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_780581.1 Gene:Rdh13 / 108841 MGIID:1918732 Length:334 Species:Mus musculus


Alignment Length:288 Identity:104/288 - (36%)
Similarity:155/288 - (53%) Gaps:16/288 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSS 185
            |:|.::||||.|||.:||..||..|..:|.|||:....|.|.:.|..|  ....|.|...|||:|
Mouse    38 GKTVIVTGANTGIGKQTALELAKRGGNVILACRDMEKCEVAAKDIRGE--TLNPRVRAERLDLAS 100

  Fly   186 LRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLT-LQLETL-FDY 248
            |:|::.|..::.:....:|.|:.||.|...|:..|.||.|..|.|::|.||.|| |.|:.| ...
Mouse   101 LKSIREFARKVIKEEERVDILVNNAAVMRCPHWTTEDGFEMQFGVNYLGHFLLTNLLLDKLKASA 165

  Fly   249 KTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWKQRGISV 313
            .:|||.|||.:|...::..|:     |:...:||.:..||..:||..|||.:||:.|.:..|::|
Mouse   166 PSRIINLSSLAHVAGHIDFED-----LNWQMKKYDTKAAYCQSKLAVVLFTKELSHRLQGSGVTV 225

  Fly   314 FSLHPGNMVSSDLSRNYWFYRLLFA--IVRPF----TKSLQQAAATSIYCATANELTGLSGLYFN 372
            .:|||| :..::|.|:...:...|:  ::.||    .||.|.||..|.|.|.|.||..:||.||:
Mouse   226 NALHPG-VARTELGRHTGMHNSAFSGFMLGPFFWLLFKSPQLAAQPSTYLAVAEELENVSGKYFD 289

  Fly   373 NCFFCEPSKLSKSAALQQQLWKLSENLI 400
            ......||..::...:.::||..|..|:
Mouse   290 GLREKAPSPEAEDEEVARRLWTESARLV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 104/288 (36%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 104/288 (36%)
Rdh13NP_780581.1 NADB_Rossmann 38..313 CDD:419666 102/282 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.