DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and dhrs12lb

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_002660947.2 Gene:dhrs12lb / 100334077 ZFINID:ZDB-GENE-131121-6 Length:345 Species:Danio rerio


Alignment Length:285 Identity:87/285 - (30%)
Similarity:131/285 - (45%) Gaps:32/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RQRFDSCSTALQVLHGKDLH----GRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAA 161
            |..|::.|.:..   .|||.    ||:.:|||||.|||..||.::|..|..:...|||:..||.|
Zfish    39 RSGFENASKSFA---AKDLDVSMVGRSFMITGANSGIGKATAMAIAKKGGTVHIVCRNKEKAERA 100

  Fly   162 IERIAQERPAARSRCRFA-ALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLE 225
            .|.|..   |:.:...|. .||||..|.|..|.|..|:..:.::.||.|||..........||||
Zfish   101 REEIVS---ASGNTMVFVHVLDLSESRKVWEFAEAFKKEHTSLNVLINNAGCMVNQREINSDGLE 162

  Fly   226 TTFQVSHLSHFYLTLQLETLFDYK--TRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAY 288
            ..|..:.|..:.||..|..|.:..  .|:|.:||     ..:.|:.|....|.....::.:.|.|
Zfish   163 KNFATNTLGVYILTKCLIPLLEKSRDPRVITVSS-----GGMLVQKLNPDDLQTERAQFDATMVY 222

  Fly   289 NNAKLCNVLFAQELAQRWKQRGISVFSLHPG----NMVSSDLSRNYWFYRLLFAIVRPFTKSLQQ 349
            ...|...|:..:..|:.:.:...||  :|||    ..|:|.:.:   ||:|:    |...:|.:|
Zfish   223 AQNKRQQVVMTEFWAKAYPKIHFSV--MHPGWADTPAVASAMPQ---FYQLM----RDRLRSAEQ 278

  Fly   350 AAATSIYCATAN-ELTGLSGLYFNN 373
            .:.|.|:.|.:. .:|..|||:|.:
Zfish   279 GSDTLIWLAMSRVTITFPSGLFFQD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 86/282 (30%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 81/261 (31%)
dhrs12lbXP_002660947.2 SDR 60..314 CDD:330230 81/261 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.