DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and si:dkey-73n8.3

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001186991.1 Gene:si:dkey-73n8.3 / 100150965 ZFINID:ZDB-GENE-141219-27 Length:296 Species:Danio rerio


Alignment Length:288 Identity:103/288 - (35%)
Similarity:160/288 - (55%) Gaps:20/288 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDL 183
            |.|:||::||||.|||.|||:.||:.|..:|.|||:...||.|...|:::...|....|  .|||
Zfish    18 LDGKTAIVTGANTGIGKETAKDLANRGARVILACRDLVKAEQAASDISRDVENANVVVR--KLDL 80

  Fly   184 SSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLTLQLETLFDY 248
            :..:|:..|.|.|..:...:..||.||||...||:.||||.||.|.|:||.||:||..|..|..:
Zfish    81 ADTKSICEFAELIYNTEKSLHLLINNAGVAICPYSTTVDGFETQFGVNHLGHFFLTFLLIDLLKH 145

  Fly   249 K--TRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWKQRGI 311
            .  :|:|.:||..|....:..|:|      ...:.|..:.||..:||.|:||.:|||.|.::.|:
Zfish   146 SAPSRVINVSSLVHPMGKIHFEDL------NSEKNYHPVKAYVQSKLANILFTRELASRVEELGV 204

  Fly   312 SVFSLHPGNMVSSDLSRNYW----FYRLLFAIVRPFTKSLQQAAATSIYCATANELTGLSGLYFN 372
            .|:::.|| :|::|::|:..    |:...|..:   .|:..:.|.|::|||...:|.  :|.|::
Zfish   205 RVYAVDPG-LVNTDITRHLMKPVQFFVKTFGFM---IKTPAEGAYTTLYCALTPDLP--TGSYYS 263

  Fly   373 NCFFCEPSKLSKSAALQQQLWKLSENLI 400
            ||.....|:.:|......:||.:|.:|:
Zfish   264 NCAVASCSRAAKDDNSASKLWAVSCHLL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 103/288 (36%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 102/286 (36%)
si:dkey-73n8.3NP_001186991.1 PRK06197 19..295 CDD:235737 102/287 (36%)
NADB_Rossmann 20..287 CDD:304358 100/280 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.