DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirup and SDH8

DIOPT Version :9

Sequence 1:NP_001285734.1 Gene:Sirup / 34089 FlyBaseID:FBgn0031971 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_009828.2 Gene:SDH8 / 852572 SGDID:S000000473 Length:138 Species:Saccharomyces cerevisiae


Alignment Length:73 Identity:25/73 - (34%)
Similarity:37/73 - (50%) Gaps:11/73 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RTEKLMAFQKKLRAKTPLGKLD-EFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPTRYGDWE 110
            ||::  :....|..|..:|... |||:       .:..:....||.|||:|||. .:|.|:||:.
Yeast    76 RTKE--SLNSPLLTKNDIGSFSPEFSK-------TIPEFEGDVNPKTGEVGGPK-QDPLRHGDYS 130

  Fly   111 RKGRVSDF 118
            ..|||:||
Yeast   131 FNGRVTDF 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SirupNP_001285734.1 DUF1674 73..118 CDD:285179 15/44 (34%)
SDH8NP_009828.2 DUF1674 <103..138 CDD:400311 15/35 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003611
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104552
Panther 1 1.100 - - LDO PTHR28524
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.960

Return to query results.
Submit another query.