powered by:
Protein Alignment Sirup and SDH8
DIOPT Version :9
Sequence 1: | NP_001285734.1 |
Gene: | Sirup / 34089 |
FlyBaseID: | FBgn0031971 |
Length: | 118 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_009828.2 |
Gene: | SDH8 / 852572 |
SGDID: | S000000473 |
Length: | 138 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 73 |
Identity: | 25/73 - (34%) |
Similarity: | 37/73 - (50%) |
Gaps: | 11/73 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 RTEKLMAFQKKLRAKTPLGKLD-EFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPTRYGDWE 110
||:: :....|..|..:|... |||: .:..:....||.|||:|||. .:|.|:||:.
Yeast 76 RTKE--SLNSPLLTKNDIGSFSPEFSK-------TIPEFEGDVNPKTGEVGGPK-QDPLRHGDYS 130
Fly 111 RKGRVSDF 118
..|||:||
Yeast 131 FNGRVTDF 138
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003611 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_104552 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR28524 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
4 | 3.960 |
|
Return to query results.
Submit another query.