DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirup and CG15283

DIOPT Version :9

Sequence 1:NP_001285734.1 Gene:Sirup / 34089 FlyBaseID:FBgn0031971 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_652574.3 Gene:CG15283 / 50454 FlyBaseID:FBgn0028844 Length:126 Species:Drosophila melanogaster


Alignment Length:126 Identity:64/126 - (50%)
Similarity:78/126 - (61%) Gaps:15/126 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RQTARVLPQMGKQVSYLSTSGAWRATASGGDMVVEIKEPKTR---------TEKL----MAFQKK 57
            |....::.|.|..:...|.:.|  |:....|.|.|::.|..|         .|||    :||::|
  Fly     3 RSCRALISQCGLHLRRCSLAKA--ASNLKKDDVEEMETPANRQRVELPPNPEEKLSKRYLAFREK 65

  Fly    58 LRAKTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPTRYGDWERKGRVSDF 118
            ||::.||..|.|.:.||..||||||||||.||||||||||.|||||||||||||||||:||
  Fly    66 LRSEAPLEPLPECAPHPAHEKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKGRVTDF 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SirupNP_001285734.1 DUF1674 73..118 CDD:285179 39/44 (89%)
CG15283NP_652574.3 DUF1674 81..126 CDD:285179 39/44 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464240
Domainoid 1 1.000 58 1.000 Domainoid score I3959
eggNOG 1 0.900 - - E1_KOG3245
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5305
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530126at2759
OrthoFinder 1 1.000 - - FOG0003611
OrthoInspector 1 1.000 - - otm25588
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR28524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3477
109.900

Return to query results.
Submit another query.