DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirup and sdhaf4

DIOPT Version :9

Sequence 1:NP_001285734.1 Gene:Sirup / 34089 FlyBaseID:FBgn0031971 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001008179.1 Gene:sdhaf4 / 493541 XenbaseID:XB-GENE-1007482 Length:118 Species:Xenopus tropicalis


Alignment Length:95 Identity:43/95 - (45%)
Similarity:50/95 - (52%) Gaps:11/95 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SGAWRA-TASGGDMVVEIKEPKTRTEKLMAFQKKLRAKTPLGKLDEFSRHPYQEKEPLKPWPNQT 88
            ||.|.: .|...:....||..|         |...:..||.||.|: |.....||.||:.:|:..
 Frog    34 SGLWNSCRALSHNSQHNIKGTK---------QPLKKPTTPQGKFDD-SEQTTLEKNPLEKFPDDI 88

  Fly    89 NPYTGEIGGPAGPEPTRYGDWERKGRVSDF 118
            ||.|.|.|||.|||||||||||||||..||
 Frog    89 NPVTKEKGGPRGPEPTRYGDWERKGRCIDF 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SirupNP_001285734.1 DUF1674 73..118 CDD:285179 27/44 (61%)
sdhaf4NP_001008179.1 DUF1674 76..118 CDD:311723 27/41 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9574
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530126at2759
OrthoFinder 1 1.000 - - FOG0003611
OrthoInspector 1 1.000 - - otm48196
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4103
SonicParanoid 1 1.000 - - X3477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.