DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirup and W02D3.12

DIOPT Version :9

Sequence 1:NP_001285734.1 Gene:Sirup / 34089 FlyBaseID:FBgn0031971 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_740875.1 Gene:W02D3.12 / 259380 WormBaseID:WBGene00020937 Length:89 Species:Caenorhabditis elegans


Alignment Length:79 Identity:43/79 - (54%)
Similarity:51/79 - (64%) Gaps:7/79 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EIKEPKTRTEKLMAFQKKLRAKTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPT 104
            :||..::..||:||      .|||.|.||:.....|::.. ||..|...|..|||:|||||||||
 Worm    18 DIKPKQSAKEKVMA------EKTPKGALDKADEQQYEDPH-LKKHPGGVNKSTGEVGGPAGPEPT 75

  Fly   105 RYGDWERKGRVSDF 118
            ||||||||||||||
 Worm    76 RYGDWERKGRVSDF 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SirupNP_001285734.1 DUF1674 73..118 CDD:285179 29/44 (66%)
W02D3.12NP_740875.1 DUF1674 48..89 CDD:285179 28/41 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164621
Domainoid 1 1.000 69 1.000 Domainoid score I6298
eggNOG 1 0.900 - - E1_KOG3245
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I3760
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28941
OrthoDB 1 1.010 - - D1530126at2759
OrthoFinder 1 1.000 - - FOG0003611
OrthoInspector 1 1.000 - - otm14607
orthoMCL 1 0.900 - - OOG6_104552
Panther 1 1.100 - - LDO PTHR28524
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4103
SonicParanoid 1 1.000 - - X3477
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.