DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirup and SDHAF4

DIOPT Version :9

Sequence 1:NP_001285734.1 Gene:Sirup / 34089 FlyBaseID:FBgn0031971 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_660310.2 Gene:SDHAF4 / 135154 HGNCID:20957 Length:108 Species:Homo sapiens


Alignment Length:117 Identity:46/117 - (39%)
Similarity:60/117 - (51%) Gaps:35/117 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VSYLSTSGAWRATAS--------------GG--DMVVE-IKEPKTRTEKLMAFQKKLRAKTPLGK 66
            :|::|.: ||||..|              ||  ::|.: :|:|                |.|.|:
Human    10 LSWVSAT-AWRAARSPLLCHSLRKTSSSQGGKSELVKQSLKKP----------------KLPEGR 57

  Fly    67 LDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPTRYGDWERKGRVSDF 118
            .|. ....:.|||||:.:|:..||.|.|.|||.|||||||||||||||..||
Human    58 FDA-PEDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SirupNP_001285734.1 DUF1674 73..118 CDD:285179 28/44 (64%)
SDHAF4NP_660310.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..108 37/93 (40%)
DUF1674 66..108 CDD:400311 28/41 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156599
Domainoid 1 1.000 70 1.000 Domainoid score I9553
eggNOG 1 0.900 - - E1_KOG3245
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5295
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530126at2759
OrthoFinder 1 1.000 - - FOG0003611
OrthoInspector 1 1.000 - - otm40996
orthoMCL 1 0.900 - - OOG6_104552
Panther 1 1.100 - - LDO PTHR28524
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4103
SonicParanoid 1 1.000 - - X3477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.