DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pes and Scarb1

DIOPT Version :9

Sequence 1:NP_001137808.1 Gene:pes / 34087 FlyBaseID:FBgn0031969 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_038945027.1 Gene:Scarb1 / 25073 RGDID:2302 Length:516 Species:Rattus norvegicus


Alignment Length:296 Identity:84/296 - (28%)
Similarity:149/296 - (50%) Gaps:14/296 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 QGVTITKTVDEMLFKGYEHPFISVGKLLRPQDVPYK-RIGYHYPRNGSSEFDGDINMFTGADDIA 232
            |...:.:||.|:|: |||.||::......|...|.| :.|.....|.||  .|...:|||..:.:
  Rat   175 QRAFMNRTVGEILW-GYEDPFVNFLSKYFPDMFPIKGKFGLFVGMNDSS--SGVFTVFTGVQNFS 236

  Fly   233 KMGQIHTWNNLTHTGAFEG-TCGQVHGSMGEFFPPNLGTKDTVYMYMPKMCRAIPLDYVETVTVH 296
            |:..:..||.|:....:.. .|..::|:.|:.:.|.:..:.::..:.|:.||::.|.|.|:....
  Rat   237 KIHLVDKWNGLSEVNYWHSEQCNMINGTAGQMWAPFMTPESSLEFFSPEACRSMKLTYQESRVFE 301

  Fly   297 GVTAYKFSGTRHAVDNGTLYPDTRCYCVGGKCMPSGVINIGPCSFNASVYMSFPHFYMADPSYLE 361
            |:..|:|:.......||::||....:|   .|..||:.|:..|.|.|.:::|.||||.|||...|
  Rat   302 GIPTYRFTAPDTLFANGSVYPPNEGFC---PCRESGIQNVSTCRFGAPLFLSQPHFYNADPVLSE 363

  Fly   362 AIEGLRPEREKHEFFMALEPNAGVPMDVGGGFQANYYMEPIPGITLYENVPTVMIPMMWCEER-- 424
            |:.||.|:.::|..|:.:.|..|:||:.....|.:.|::.:.|:.....:..|::|::|.|:.  
  Rat   364 AVLGLNPDPKEHSLFLDIHPVTGIPMNCSVKMQLSLYIKSVKGVGQTGKIEPVVLPLLWFEQSGM 428

  Fly   425 --VRVSEEIAADIALVPLIVLLGQIVTGILLAGGLI 458
              .:........:.|:|.::...|.|  :|..|||:
  Rat   429 MGGKTLNTFYTQLVLMPQVLHYAQYV--LLGLGGLL 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pesNP_001137808.1 CD36 14..463 CDD:279474 84/296 (28%)
Scarb1XP_038945027.1 CD36 <148..454 CDD:395898 79/284 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342072
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3776
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45589
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11923
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X155
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.