DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7231 and FAM151A

DIOPT Version :9

Sequence 1:NP_723327.1 Gene:CG7231 / 34086 FlyBaseID:FBgn0031968 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_788954.2 Gene:FAM151A / 338094 HGNCID:25032 Length:585 Species:Homo sapiens


Alignment Length:297 Identity:95/297 - (31%)
Similarity:150/297 - (50%) Gaps:41/297 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VEQTAPDDSQIEYIF----LKQSDMMKVWGTNLTAITWAHAVNSQQLLDEVLTETSGIDFIEADI 96
            :|..:||...::|:.    :.:.|.::|        ||.||.||::.:...|  .|.|..:|||:
Human    43 LEACSPDADMLDYLLSLGQISRRDALEV--------TWYHAANSKKAMTAAL--NSNITVLEADV 97

  Fly    97 ---VLGKLNGDGEDMPIMAHPPANVSDLTLSEFLNQIINFNRDHEDQKKGVKLDFKSIEVFEGSL 158
               .||..|..|  :|||||||...||.||.::|:.::.      ..:||:|||||:|:....||
Human    98 NVEGLGTANETG--VPIMAHPPTIYSDNTLEQWLDAVLG------SSQKGIKLDFKNIKAVGPSL 154

  Fly   159 DILDVNIPNVSLPTTYPVWINADILSGPVEQNRTV--PVDADRFFAGCM-RYKQAVLSIGWTTNW 220
            |:|........:  ..|:|||||||.||   |..:  .|:|.:|.|... :|.:|.||.||||.:
Human   155 DLLRQLTEEGKV--RRPIWINADILKGP---NMLISTEVNATQFLALVQEKYPKATLSPGWTTFY 214

  Fly   221 GADFRDGEYTQQQCDDMLETLSENNVLSTGQAITFPVRAGIAANSEEQLHRLVAAVNETNESTLT 285
            .:...:..|||...:.|.|.:.     ...|.:|||||:.:...:......|   ::::...:||
Human   215 MSTSPNRTYTQAMVEKMHELVG-----GVPQRVTFPVRSSMVRAAWPHFSWL---LSQSERYSLT 271

  Fly   286 IWSSAGDYVDVDKLRKLIFSFGLDRVYLDVPEELASQ 322
            :|.:|.|.:.|:.|..:..:..:.:||.|:.|.|.||
Human   272 LWQAASDPMSVEDLLYVRDNTAVHQVYYDIFEPLLSQ 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7231NP_723327.1 DUF2181 63..319 CDD:287226 86/261 (33%)
FAM151ANP_788954.2 DUF2181 66..306 CDD:287226 88/270 (33%)
DUF2181 338..575 CDD:287226
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145090
Domainoid 1 1.000 127 1.000 Domainoid score I5374
eggNOG 1 0.900 - - E1_KOG3748
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1117332at2759
OrthoFinder 1 1.000 - - FOG0003384
OrthoInspector 1 1.000 - - otm41130
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21184
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.